DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and AT1G50060

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_175428.1 Gene:AT1G50060 / 841430 AraportID:AT1G50060 Length:161 Species:Arabidopsis thaliana


Alignment Length:135 Identity:42/135 - (31%)
Similarity:63/135 - (46%) Gaps:12/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKYGENIFLSGGMDVTGD 97
            ::..|:.|..||..|.|.|..:..|...|..::|..:....:.|...| ||||:........:..
plant    28 QDYLNSHNTARAQVGVPNVVWDTTLAAYALNYSNFRKADCNLVHSNGP-YGENLAKGSSSSFSAI 91

  Fly    98 LPVEMWYRE--INSYDFNKAQFVPTAG----HFTQLIWKSSVEMGSGVARKADRTWVV-CNYNPP 155
            ..|::|..|  ..||.:|..    |.|    |:||::|:.||::|....:..:..|.| ||||.|
plant    92 SAVKLWVDEKPYYSYAYNNC----TGGKQCLHYTQVVWRDSVKIGCARVQCTNTWWFVSCNYNSP 152

  Fly   156 GNVVG 160
            ||.||
plant   153 GNWVG 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 39/131 (30%)
AT1G50060NP_175428.1 CAP_PR-1 27..161 CDD:349400 42/135 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.