DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and AT1G50050

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_175427.1 Gene:AT1G50050 / 841429 AraportID:AT1G50050 Length:226 Species:Arabidopsis thaliana


Alignment Length:124 Identity:33/124 - (26%)
Similarity:54/124 - (43%) Gaps:3/124 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKYGENIFLSGGMDVTGD 97
            ::..||.|..||..|...|..:..:...|..:||..:...::.......||||:........||.
plant    28 QDYLNTHNTARAQVGVANVVWDTVVAAYATNYANARKVDCSLTPSTGGSYGENLANGNNALFTGV 92

  Fly    98 LPVEMWYREINSYDF--NKAQFVPTAGHFTQLIWKSSVEMG-SGVARKADRTWVVCNYN 153
            ..|.:|..|...|::  |.........|:||::|.:||::| :.|.......:|.|||:
plant    93 AAVNLWVNEKPYYNYTANACIGAQQCKHYTQVVWSNSVKIGCARVLCNNGGYFVGCNYD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 33/124 (27%)
AT1G50050NP_175427.1 SCP 27..151 CDD:294090 32/122 (26%)
Radical_SAM <155..185 CDD:302752
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.