DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and CRISPLD2

DIOPT Version :10

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_113664.1 Gene:CRISPLD2 / 83716 HGNCID:25248 Length:497 Species:Homo sapiens


Alignment Length:156 Identity:38/156 - (24%)
Similarity:60/156 - (38%) Gaps:32/156 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KEVFNTTNKYRAM-----HGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNP---KYGENIFLS 89
            :|:....||.|..     .....:|.:..|.|.|..||:    |....|.|..   ..|:|:...
Human    57 EEILMLHNKLRGQVQPQASNMEYMTWDDELEKSAAAWAS----QCIWEHGPTSLLVSIGQNLGAH 117

  Fly    90 GGMDVTGDLPVEMWYREINSYDFNKAQFV----------PTAGHFTQLIWKSSVEMGSGV--ARK 142
            .|...:....|:.||.|:..|.:......          |...|:||::|.::.::|..|  .||
Human   118 WGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRK 182

  Fly   143 --------ADRTWVVCNYNPPGNVVG 160
                    .:..:.||||:|.||.:|
Human   183 MTVWGEVWENAVYFVCNYSPKGNWIG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 CAP_GAPR1-like 31..158 CDD:349401 36/152 (24%)
CRISPLD2NP_113664.1 CAP_CRISPLD2 56..201 CDD:349410 33/147 (22%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:427521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.