DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and CRISPLD1

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:168 Identity:37/168 - (22%)
Similarity:65/168 - (38%) Gaps:38/168 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RGQDTKGNNELFLKEVFNTTNKYRAM-----HGCPAVTINAALNKLAQEWANHLRDQNTMAHRPN 79
            ||:....:|:  ::.:.:..||.|:.     .....:|.:..|.:.|:.||    :.....|.|.
Human    52 RGKRAITDND--MQSILDLHNKLRSQVYPTASNMEYMTWDVELERSAESWA----ESCLWEHGPA 110

  Fly    80 ---PKYGENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFV----------PTAGHFTQLIWKS 131
               |..|:|:....|........|:.||.|:..:.:......          |...|:||::|.:
Human   111 SLLPSIGQNLGAHWGRYRPPTFHVQSWYDEVKDFSYPYEHECNPYCPFRCSGPVCTHYTQVVWAT 175

  Fly   132 SVEMGSGVA------------RKADRTWVVCNYNPPGN 157
            |..:|..:.            .||  .::||||:|.||
Human   176 SNRIGCAINLCHNMNIWGQIWPKA--VYLVCNYSPKGN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 34/157 (22%)
CRISPLD1NP_113649.1 SCP_euk 63..207 CDD:240180 30/149 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281
LCCL 291..375 CDD:128866
LCCL 392..483 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.