DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and AT5G66590

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_201460.1 Gene:AT5G66590 / 836791 AraportID:AT5G66590 Length:185 Species:Arabidopsis thaliana


Alignment Length:128 Identity:45/128 - (35%)
Similarity:63/128 - (49%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRP-NP-KYGEN-IFLSGGMDVTGDLPVE 101
            ||.|||.|.|.:..:..|...|...|.:.|:|....... || |||.| ::..|.:.||..|.||
plant    54 NKARAMVGVPPLVWSQTLEAAASRLARYQRNQKKCEFASLNPGKYGANQLWAKGLVAVTPSLAVE 118

  Fly   102 MWYREINSYDFNKAQFVP--TAGHFTQLIWKSSVEMGSGVA--RKADRTWVVCNYNPPGNVVG 160
            .|.:|...|::.......  |.|.:.|::|::|.|:|...|  .|......:|.|||||||:|
plant   119 TWVKEKPFYNYKSDTCAANHTCGVYKQVVWRNSKELGCAQATCTKESTVLTICFYNPPGNVIG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 42/124 (34%)
AT5G66590NP_201460.1 CAP_PR-1 46..185 CDD:349400 45/128 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.