DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and AT5G02730

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_195893.1 Gene:AT5G02730 / 831820 AraportID:AT5G02730 Length:205 Species:Arabidopsis thaliana


Alignment Length:155 Identity:45/155 - (29%)
Similarity:68/155 - (43%) Gaps:15/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RGQDTKGNNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKYGE 84
            ||:..|.:.|..|..     |..|...|...:..:..|.:.|.:||...:....|.|...| |||
plant    50 RGRRNKQSAEFLLAH-----NAARVASGASNLRWDQGLARFASKWAKQRKSDCKMTHSGGP-YGE 108

  Fly    85 NIF-LSGGMDVTGDLPVEMWYREINSYD--FNKAQFVPTAGHFTQLIWKSSVEMGSGVAR-KADR 145
            ||| .....:.:....|:.|..|..:||  .|..:.....||:||::|:::..:  |.|| |.|.
plant   109 NIFRYQRSENWSPRRVVDKWMDESLNYDRVANTCKSGAMCGHYTQIVWRTTTAV--GCARSKCDN 171

  Fly   146 T---WVVCNYNPPGNVVGLFKDNVP 167
            .   .|:|.|:|.||..|....::|
plant   172 NRGFLVICEYSPSGNYEGESPFDIP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 38/133 (29%)
AT5G02730NP_195893.1 SCP_PR-1_like 57..193 CDD:240181 41/143 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.