DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and AT4G33730

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_195099.1 Gene:AT4G33730 / 829515 AraportID:AT4G33730 Length:172 Species:Arabidopsis thaliana


Alignment Length:154 Identity:48/154 - (31%)
Similarity:76/154 - (49%) Gaps:21/154 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PKTHERPPGPRGQDTKGNNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRD-QNT 73
            |::||.|            :.:|:    ..|..||......:..:..:..:||::||||.. ..:
plant    33 PQSHEYP------------DSYLR----PHNAARAAVKVKPLRWDFGIATVAQDYANHLASGPCS 81

  Fly    74 MAHRPNPKYGENIFLSGGMDVTGDLPVEMWYREINSYDF-NKAQFVPTAGHFTQLIWKSSVEMGS 137
            :.|...| ||||:....| |::....|.||..|.:.||| :.:...|..||:||::|:.|..:|.
plant    82 LEHSSGP-YGENLAFGSG-DMSAAQAVAMWVHEKSYYDFYSNSCHGPACGHYTQVVWRGSARLGC 144

  Fly   138 GVAR-KADRTWVVCNYNPPGNVVG 160
            |.|: ....:.|||||:|.||.:|
plant   145 GKAKCNNGASIVVCNYDPAGNYIG 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 42/129 (33%)
AT4G33730NP_195099.1 CAP_PR-1 39..172 CDD:349400 45/148 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.