DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and AT4G33710

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_195097.1 Gene:AT4G33710 / 829513 AraportID:AT4G33710 Length:166 Species:Arabidopsis thaliana


Alignment Length:147 Identity:45/147 - (30%)
Similarity:70/147 - (47%) Gaps:16/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RGQDTKGNNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWA-NHLRDQNTMAHRPNPKYG 83
            :.||.:       ::..:..|..|.....|.:..:|...:.|..:| ...||...:......:||
plant    26 KAQDRR-------QDYLDVHNHARDDVSVPHIKWHAGAARYAWNYAQRRKRDCRLIHSNSRGRYG 83

  Fly    84 ENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFV---PTAGHFTQLIWKSSVEMGSGVARKADR 145
            ||:..|.| |::|...|.:|.||.:.| |:|:...   ...||:||::||:|..:|.... |.|.
plant    84 ENLAWSSG-DMSGAAAVRLWVREKSDY-FHKSNTCRAGKQCGHYTQVVWKNSEWVGCAKV-KCDN 145

  Fly   146 --TWVVCNYNPPGNVVG 160
              |:|.|||:.||||.|
plant   146 GGTFVTCNYSHPGNVRG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 40/132 (30%)
AT4G33710NP_195097.1 CAP_PR-1 32..166 CDD:349400 43/134 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.