DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and AT4G31470

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_194875.1 Gene:AT4G31470 / 829274 AraportID:AT4G31470 Length:185 Species:Arabidopsis thaliana


Alignment Length:166 Identity:49/166 - (29%)
Similarity:70/166 - (42%) Gaps:15/166 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PIPKTHERPPGPR---------GQDTKGNNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQE 63
            |:|....:.|..|         .||.........::.....|..||....|.:..:.:|...|..
plant    18 PLPSLSFQIPSNRTPTTSTLIFSQDKALARNTIQQQFLRPHNILRAKLRLPPLKWSNSLALYASR 82

  Fly    64 WANHLRDQNTMAHRPNPKYGENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFVPTAG---HFT 125
            ||...|....:.|...| ||||:|...|...|....|..|..|:..|| .:.......|   |:|
plant    83 WARTRRGDCKLIHSGGP-YGENLFWGSGKGWTPRDAVAAWASEMKYYD-RRTSHCKANGDCLHYT 145

  Fly   126 QLIWKSSVEMGSGVA-RKADRTWVVCNYNPPGNVVG 160
            ||:||.|..:|..:: .|...|:::|||:||||:||
plant   146 QLVWKKSSRIGCAISFCKTGDTFIICNYDPPGNIVG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 40/130 (31%)
AT4G31470NP_194875.1 CAP_PR-1 51..185 CDD:349400 43/133 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101367
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.730

Return to query results.
Submit another query.