DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and AT4G07820

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_192524.1 Gene:AT4G07820 / 826263 AraportID:AT4G07820 Length:160 Species:Arabidopsis thaliana


Alignment Length:135 Identity:28/135 - (20%)
Similarity:57/135 - (42%) Gaps:26/135 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKYGENIFLSGG------ 91
            ::.||..|:.|...|...:..:..|...||.:|...||.             .:|||||      
plant    30 QDYFNAHNRARVSVGVSPLMWSQTLTAYAQAYAEKRRDC-------------GLFLSGGPYGETI 81

  Fly    92 ----MDVTGDLPVEMWYREINSYDF--NKAQFVPTAGHFTQLIWKSSVEMGSGVARKADRTWV-V 149
                :|.:.:..|..:..:.:.||:  |..:...:...:.|::::.||.:|....:..:..:: :
plant    82 KADIIDFSAEEFVSTFLNQKSDYDYTTNTCRAGKSCDGYKQVLFRKSVFLGCAKVKCNNGGFLAI 146

  Fly   150 CNYNP 154
            |:|:|
plant   147 CSYDP 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 28/135 (21%)
AT4G07820NP_192524.1 CAP_PR-1 29..160 CDD:349400 28/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.830

Return to query results.
Submit another query.