DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and PR-1-LIKE

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_179589.1 Gene:PR-1-LIKE / 816518 AraportID:AT2G19990 Length:176 Species:Arabidopsis thaliana


Alignment Length:153 Identity:50/153 - (32%)
Similarity:74/153 - (48%) Gaps:11/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 THERPPGPRGQDTKGNNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAH 76
            |..:||     ....|.::..:|.....||.|||.|...:..|..|...||.:|:.......|.|
plant    27 TPAQPP-----KANANGDVKPQETLVVHNKARAMVGVGPMVWNETLATYAQSYAHERARDCAMKH 86

  Fly    77 RPNPKYGENIFLSGGMDVTGDLPVEMWYREINSYDF--NKAQFVPTAGHFTQLIWKSSVEMGSGV 139
            ...| :|||: .:|...::|.:..|.|..|..:||:  |........||:||::|:.||.:|...
plant    87 SLGP-FGENL-AAGWGTMSGPVATEYWMTEKENYDYDSNTCGGDGVCGHYTQIVWRDSVRLGCAS 149

  Fly   140 AR-KADR-TWVVCNYNPPGNVVG 160
            .| |.|. .||:|:|:||||.:|
plant   150 VRCKNDEYIWVICSYDPPGNYIG 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 44/130 (34%)
PR-1-LIKENP_179589.1 CAP_PR-1 42..176 CDD:349400 46/133 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.