DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Crispld2

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001297564.1 Gene:Crispld2 / 78892 MGIID:1926142 Length:495 Species:Mus musculus


Alignment Length:156 Identity:39/156 - (25%)
Similarity:64/156 - (41%) Gaps:32/156 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KEVFNTTNKYRAMHGCPA-----VTINAALNKLAQEWANHLRDQNTMAHRPN---PKYGENIFLS 89
            :|:....||.|.....||     :|.:..|.:.|..||:..    ...|.|.   ...|:|:.:.
Mouse    57 QEILMLHNKLRGQVYPPASNMEHMTWDEELERSAAAWAHRC----LWEHGPAGLLRSIGQNLAVH 117

  Fly    90 GGMDVTGDLPVEMWYREINSYDF----------NKAQFVPTAGHFTQLIWKSSVEMGSGV--ARK 142
            .|...:....|:.||.|:..|.:          .:....|...|:||::|.::.::|..|  .|.
Mouse   118 WGRYRSPGFHVQSWYDEVKDYTYPYPHECTPRCRERCSGPMCTHYTQMVWATTNKIGCAVHTCRN 182

  Fly   143 AD---RTW-----VVCNYNPPGNVVG 160
            .:   .||     :||||:|.||.:|
Mouse   183 MNVWGDTWENAVYLVCNYSPKGNWIG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 37/152 (24%)
Crispld2NP_001297564.1 CAP 56..201 CDD:381818 34/147 (23%)
LCCL 284..368 CDD:128866
LCCL 387..486 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.