DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Pi16

DIOPT Version :10

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_076223.3 Gene:Pi16 / 74116 MGIID:1921366 Length:498 Species:Mus musculus


Alignment Length:153 Identity:46/153 - (30%)
Similarity:67/153 - (43%) Gaps:30/153 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NKYRAMHGCPAVTINAALNKLAQEWANHL-------RDQNTMAH-RPNPKYGENIF--LSGGMDV 94
            |:|||....|      |.:.|...|.:.|       ..:....| :...:.|||:|  ...||||
Mouse    43 NQYRAQVSPP------ASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGENLFAITDEGMDV 101

  Fly    95 TGDLPVEMWYREINSYDFNKAQFVPT--AGHFTQLIWKSSVEMGSGV--------ARKADRTWVV 149
              .|.|..|:.|...|:|:.|...|.  .||:||::|..:..:|.|.        ..:|:...:|
Mouse   102 --PLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLV 164

  Fly   150 CNYNPPGNVVGL--FKDNVPPKQ 170
            |||.|||||.|.  :::..|..|
Mouse   165 CNYEPPGNVKGRKPYQEGTPCSQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 CAP_GAPR1-like 31..158 CDD:349401 41/137 (30%)
Pi16NP_076223.3 CAP_PI16_HrTT-1 35..168 CDD:349405 37/132 (28%)
DUF5585 <183..458 CDD:465521 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..277
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..467
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.