DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_080499.1 Gene:Glipr1l2 / 67537 MGIID:1914787 Length:332 Species:Mus musculus


Alignment Length:159 Identity:44/159 - (27%)
Similarity:69/159 - (43%) Gaps:27/159 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NNELFLKEVFNTTNKYRAMHG-------CPAV-----TINAALNKLAQEWANH-LRDQNT---MA 75
            |.:|.|:|..:..|:|..:|.       .|.|     |.:.||::.|:.|... :..:||   ..
Mouse    39 NAKLPLEEDVDFINEYVGLHNELRGTVFPPGVNLRFMTWDVALSRTARAWGKKCMYSRNTHLDKL 103

  Fly    76 HRPNPKY---GENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFV--PTAGHFTQLIWKSSVEM 135
            |..:|.:   |||:::....|.|....:..|:.|..||.:.....|  ....|:.||:|.||.::
Mouse   104 HESHPVFTEIGENMWVGPVEDFTVTTAIRSWHEERKSYSYLNDTCVEDQNCSHYIQLVWDSSYKV 168

  Fly   136 GSGV---ARKADRTWV---VCNYNPPGNV 158
            |..|   ||....|..   :|||.|.|.:
Mouse   169 GCAVTSCARAGGFTHAALFICNYAPGGTL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 42/153 (27%)
Glipr1l2NP_080499.1 SCP 49..194 CDD:294090 38/144 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841198
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.