DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Crisp3

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:145 Identity:43/145 - (29%)
Similarity:71/145 - (48%) Gaps:23/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KEVFNTTNKYR---AMHGCPAVTI----NAALNKLAQEWANH-LRDQNTMAHRPNP-KYGENIFL 88
            :|:.|..|:.|   :..|...:.:    :|.:|  ||:|||. :.:.:.:.||... |.|||:|:
  Rat    42 EEIINKHNQLRRTVSPSGSDLLRVEWDHDAYVN--AQKWANRCIYNHSPLQHRTTTLKCGENLFM 104

  Fly    89 SGGMDVTGDLPVEMWYREINSYDFNKAQFVP-----TAGHFTQLIWKSSVEMGSGVARKAD---R 145
            : ....:....::.||.|...:.|.   |.|     ..||:||::|.|:..:..|||...|   :
  Rat   105 A-NYPASWSSVIQDWYDESLDFVFG---FGPKKVGVKVGHYTQVVWNSTFLVACGVAECPDQPLK 165

  Fly   146 TWVVCNYNPPGNVVG 160
            .:.||:|.|.||.||
  Rat   166 YFYVCHYCPGGNYVG 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 40/141 (28%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 38/137 (28%)
Crisp 192..246 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.