DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and crispld2

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001027499.1 Gene:crispld2 / 613091 XenbaseID:XB-GENE-985953 Length:500 Species:Xenopus tropicalis


Alignment Length:156 Identity:38/156 - (24%)
Similarity:63/156 - (40%) Gaps:32/156 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KEVFNTTNKYRA-MHGCPA----VTINAALNKLAQEWANHLRDQNTMAHRPNP---KYGENIFLS 89
            :|:....||.|. :|...:    :|.:..|.|.|:.||    ::....|.|..   ..|:|:.:.
 Frog    58 EEIIQLHNKLRGQVHPSASNMEYMTWDDELEKSAEAWA----EECIWEHGPTALLMSIGQNLAVH 118

  Fly    90 GGMDVTGDLPVEMWYREINSYDFNKAQFV----------PTAGHFTQLIWKSSVEMGSGV-ARKA 143
            .|........|:.||.|:..|.:......          |...|:||::|.::.::|..| ..|.
 Frog   119 WGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKR 183

  Fly   144 DRTW---------VVCNYNPPGNVVG 160
            ...|         :||||:|.||.:|
 Frog   184 MNVWGDIWENAVYLVCNYSPKGNWIG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 36/152 (24%)
crispld2NP_001027499.1 SCP_euk 57..202 CDD:240180 33/147 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..281
LCCL 289..373 CDD:128866
LCCL 392..490 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.