DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and pi15b

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:180 Identity:43/180 - (23%)
Similarity:71/180 - (39%) Gaps:51/180 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQDTKGNNELFLKE-----VFNTTNKYRAMHGCPAVTI-----NAALNKLAQEWANHLRDQNTMA 75
            |...|...:.::.:     :.:..||.||....||..:     :..|.:.|:.||      .|..
Zfish    50 GSKPKSRRKRYISQSDMIAILDYHNKVRANVFPPAANMEYMLWDDGLARSAEAWA------ATCI 108

  Fly    76 HRPNPKY-----GENIFLSGGMDVTGDLP-----VEMWYREINSYDFNKAQ----------FVPT 120
            ....|.|     |:|:.:.     ||:..     |:.||.|:..|.|...:          :.|.
Zfish   109 WEHGPPYLLRYLGQNLSVR-----TGNYRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPM 168

  Fly   121 AGHFTQLIWKSSVEMGSGV----------ARKADRTWVVCNYNPPGNVVG 160
            ..|:||::|.||..:|..:          |...:.|::||||:|.||.:|
Zfish   169 CTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 39/166 (23%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 36/153 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.