DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Glipr1l3

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001360960.1 Gene:Glipr1l3 / 544736 MGIID:3620621 Length:236 Species:Mus musculus


Alignment Length:172 Identity:47/172 - (27%)
Similarity:72/172 - (41%) Gaps:33/172 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IPKT--HERPPGPRGQDTKGNNELFLKEVFNTTNKYRAMHGCPAVTINAA-----LNKLAQEWAN 66
            :||.  ::.|..|...|.|     |:....|..|:.|.....||..:|..     |.|||:.|..
Mouse    22 LPKAFGNDLPRVPSILDPK-----FIDAFLNIHNELRRKVQPPAADMNQVIWDQKLAKLAKAWTR 81

  Fly    67 HLRDQNTMAHRP--NPKY---------GENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFVPT 120
            ..:    :.|.|  :.:|         ||||:| |.::...:..|..||.|...|:|........
Mouse    82 ECK----LGHNPCTSKQYGCLLDYDFIGENIYL-GEIETQPEDVVNNWYNENTDYNFVDNTCSKI 141

  Fly   121 AGHFTQLIWKSSVEMGSGVARKADRT-----WVVCNYNPPGN 157
            ..::|||:|..:.::|..|:...:.|     ..||||:|.||
Mouse   142 CRNYTQLVWAKTFKIGCAVSNCPNLTRYSAGLFVCNYSPTGN 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 41/148 (28%)
Glipr1l3NP_001360960.1 CAP 40..182 CDD:381818 40/151 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.