DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:155 Identity:45/155 - (29%)
Similarity:67/155 - (43%) Gaps:26/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NNELFLKEVFNTTNKYRAMHGCPAVTIN-----AALNKLAQEWANHLRDQNTMAHRP-------- 78
            |:..|.....|:.|:.|.....||..:|     .:|.|||:.|....:    .:|.|        
  Rat    37 NDPEFKNGFLNSHNEARRKVQPPASNMNQLSWDKSLAKLAKSWTRECK----FSHNPCTSKRHGC 97

  Fly    79 NPKY---GENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVA 140
            ...|   ||||:| |.:|...:..|..||.|...|:|:......|.||:||::|..::::|..::
  Rat    98 TKDYDYIGENIYL-GKIDARPEDVVFSWYNETKDYNFDDNTCTKTCGHYTQVVWAKTLKIGCAIS 161

  Fly   141 RKADRT-----WVVCNYNPPGNVVG 160
            .....|     ..||||.|.||..|
  Rat   162 NCPHLTGYSAGLFVCNYVPAGNFQG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 42/147 (29%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 40/145 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344596
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.