DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and glipr2l

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001005978.1 Gene:glipr2l / 449805 ZFINID:ZDB-GENE-041010-53 Length:154 Species:Danio rerio


Alignment Length:154 Identity:56/154 - (36%)
Similarity:79/154 - (51%) Gaps:12/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KGNNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAH-----RPNPKYGE 84
            |..:.||.:|...|.|:||..|..|.:.:::.|...|..:|..|.....:.|     |.|  .||
Zfish     3 KSASRLFSEEALKTHNEYRRKHQAPPLKLSSKLCSEASRYAESLASTRILKHSVESSRGN--CGE 65

  Fly    85 NIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVARKAD-RTWV 148
            |:..: ..|.||....:.||.|:|.|:||:..|....||||.::||.|.::|.|.|..:| .|:|
Zfish    66 NLAWA-SYDQTGKDVTDRWYNEVNQYNFNQPGFSSGTGHFTAVVWKGSKKLGVGKAVASDGSTFV 129

  Fly   149 VCNYNPPGNVV--GLFKDNV-PPK 169
            |..|.|.||:.  |.|:.|| |||
Zfish   130 VARYFPAGNITNQGHFQANVLPPK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 46/132 (35%)
glipr2lNP_001005978.1 SCP_GAPR-1_like 9..139 CDD:240182 46/132 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm26149
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.