DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Ag5r

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:158 Identity:42/158 - (26%)
Similarity:60/158 - (37%) Gaps:51/158 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KGNNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKYGENIFLS 89
            |.|:||......|..:......||.        |..|.:|:                 |:|:...
  Fly    91 KWNDELAYLASLNVKSCQMKHDGCH--------NTDAFDWS-----------------GQNLAWM 130

  Fly    90 G---GMDVTGDLP--VEMWYRE--------INSYDFNKAQFVPTAGHFTQLIWKSSVEMG----- 136
            |   .::||..|.  |:|||.|        |::|..|...  |..||||.|:...:.|:|     
  Fly   131 GYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYNG--PAIGHFTVLVADRNTEVGCAAAT 193

  Fly   137 ---SGVARKADRTWVVCNYNPPGNVVGL 161
               ||.:.||  ..:.||| ...||:|:
  Fly   194 YSVSGQSYKA--FLLACNY-AATNVLGI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 35/147 (24%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 39/149 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455141
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.