DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Ag5r2

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster


Alignment Length:142 Identity:35/142 - (24%)
Similarity:56/142 - (39%) Gaps:41/142 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NAALNKLAQEWANHLR-------DQNTMAHRPNPKYGENIFLSGGMDV-----TGDLP------- 99
            |||......||.:.|.       .|..|.|  :..:..:.|...|.::     :||||       
  Fly    82 NAACRMATMEWDDELAYLASLNVRQCNMVH--DSCHNTDAFKYSGQNLAWQAYSGDLPDMGYILD 144

  Fly   100 --VEMWYREINSYDFNKAQFV----------PTAGHFTQLIWKSSVEMGSGVARKADRTW----V 148
              |:||:.|:::   :.|..:          |..||||.::.:.:..:|...||.....|    |
  Fly   145 NSVQMWFDEVHN---SNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCAAARYNRDGWNQVLV 206

  Fly   149 VCNYNPPGNVVG 160
            .||| ...|::|
  Fly   207 ACNY-ATTNMIG 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 33/138 (24%)
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 33/134 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455126
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.