DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and CG11977

DIOPT Version :10

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:165 Identity:35/165 - (21%)
Similarity:59/165 - (35%) Gaps:44/165 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PPGPRGQDTKGNNELFLKEVFNTTNKYRAMHGCPAVT----INAALNKLAQEWANHLRDQNTMAH 76
            |...:.::.|.::||.:..:       |..:.|...|    :|..|.|...|.::.::.|||   
  Fly   103 PRAVKFKNIKWDDELSVMAM-------RVSNQCLQHTFSPCVNTFLYKDVGESSDFVKVQNT--- 157

  Fly    77 RPNPKYGENIFLSGGMDVTGDLPVEMWYREIN----SYDFNKAQFVPTAG--HFTQLIWKSSVEM 135
                        |.|.:|...|  .||:....    ||..|.....|...  .|..||::.:.:|
  Fly   158 ------------SKGFNVISFL--NMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIYEKNKKM 208

  Fly   136 GSGVARKADRTWVVCNYNPPGNVVGLFKDNVPPKQ 170
            |.|:.:.....::.|          ||...:.|.|
  Fly   209 GCGMVKSGQGRFLTC----------LFDKKIKPNQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 CAP_GAPR1-like 31..158 CDD:349401 27/136 (20%)
CG11977NP_649855.3 CAP_euk 81..226 CDD:349399 32/156 (21%)

Return to query results.
Submit another query.