DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and CG42564

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster


Alignment Length:222 Identity:41/222 - (18%)
Similarity:75/222 - (33%) Gaps:76/222 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HERPPGPRGQDTKGNN-----------ELFLKEVFNTT-NKYRAMH-----GCPAVTINAALNKL 60
            |..|.|.:||:..||:           .|..||:.:.. |....:|     ....:.|:..:.:.
  Fly    32 HPSPGGSQGQEEPGNSSSTELPDYCDPSLCHKELKHVACNASIELHDKCSLDAELIVISPKVERF 96

  Fly    61 AQEWANHLRD---------------QNTMAHRP---------------------NPKYGENIFLS 89
            .....|.|||               ..|:...|                     |.|:.:|...:
  Fly    97 LLRRFNELRDSVAKGGFNGLSPASRMGTLKWNPELAYLAEFNVRDCVLRHDECRNTKFTQNAGQT 161

  Fly    90 -GGMDVTGDLP---------VEMWYRE------INSYDFNKAQFVPTAGHFTQLIWKSSVEMGSG 138
             |...:.|.||         :.:|.||      :|...:.:.:......:|.|::.:::..:|..
  Fly   162 VGYRGIKGKLPELEDILRDIIGVWLREKSRTSMVNIMKYVEQESQSPKYNFLQIVLENAESVGCA 226

  Fly   139 VARKADRTWV----VCNY-NPPGNVVG 160
            :.:::...|:    .||| :.|  |||
  Fly   227 IVQQSRHGWIQTFFACNYGHAP--VVG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 30/189 (16%)
CG42564NP_649651.2 SCP_euk 95..245 CDD:240180 23/149 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455130
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.