DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and crisp1.7

DIOPT Version :10

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_989314.1 Gene:crisp1.7 / 394939 XenbaseID:XB-GENE-5779195 Length:244 Species:Xenopus tropicalis


Alignment Length:98 Identity:20/98 - (20%)
Similarity:33/98 - (33%) Gaps:21/98 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IAKAEPQETYWPRLLKDKTKPHWL----------KVDFNRW-----EDEGSNDEEGGADQMDLMQ 134
            :.:::.||:...|...|..:.|..          ..|..||     :|.|....:......:.|:
 Frog   143 VERSQEQESEAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPGEAME 207

  Fly   135 MLNASQNSNKLSFDDLSDEPEGEDSDDESIPGL 167
            .|..:|..     || |..|..|...::..|.|
 Frog   208 RLGRAQRC-----DD-SPAPRKERLANKDRPAL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 CAP_GAPR1-like 31..158 CDD:349401 17/87 (20%)
crisp1.7NP_989314.1 CAP_CRISP 32..171 CDD:349402 5/27 (19%)
Crisp 188..243 CDD:462519 12/53 (23%)

Return to query results.
Submit another query.