DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and glipr1b

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_005159058.1 Gene:glipr1b / 393547 ZFINID:ZDB-GENE-040426-1459 Length:255 Species:Danio rerio


Alignment Length:160 Identity:38/160 - (23%)
Similarity:63/160 - (39%) Gaps:30/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FLKEVFNTTNKYRAMHGCPAVTINAALNKL--AQEW-----------ANHLRDQN--TMAHRPNP 80
            |::......|.:||....||....:.:.::  .|.|           |.|.:..:  ::.|..:|
Zfish    33 FIRRCVKAHNTHRARVSPPAAGARSMVRQVFGMQSWDKELAKGARDRARHCKGSHYPSLGHFGHP 97

  Fly    81 KY---GENIFLSGGMDV-TGDLPVEMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGV-- 139
            .:   ||||:|...... :.:..|..|.:| .:|...........||:.||:|.:|.:||..|  
Zfish    98 LFGWMGENIWLGSPFSAFSVENAVHRWSKE-GAYSVKNNNCSRLCGHYAQLMWSTSFKMGCAVNV 161

  Fly   140 --------ARKADRTWVVCNYNPPGNVVGL 161
                    :...:.|..||||...|.|.|:
Zfish   162 CSKGIENFSTHPESTIFVCNYGDTGQVHGV 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 36/155 (23%)
glipr1bXP_005159058.1 SCP 32..185 CDD:294090 35/152 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.