DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and CG8072

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster


Alignment Length:141 Identity:32/141 - (22%)
Similarity:50/141 - (35%) Gaps:41/141 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 WANHLR---------------DQNTMA----HRPNPKYGENIF------LSGGMDVTGDLPVEMW 103
            |.|:|.               |.:.:|    ..|:..|.|:.:      .|...::|  :..|.|
  Fly    94 WDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAEDFYPRPVIRQSNVREMT--ILAEQW 156

  Fly   104 YREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVARKADRTW-----VVCNYN--PP--GNVV 159
            ..|:  ||.:........|....:|...|..||....:..| .|     :||.|:  ||  ||:.
  Fly   157 LDEL--YDLDDIATYSAEGEIRNIINDRSSYMGCAAGQDYD-LWNIHFVLVCYYSSGPPVEGNLY 218

  Fly   160 --GLFKDNVPP 168
              |:|...:.|
  Fly   219 EEGIFNATLCP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 28/127 (22%)
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 24/118 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455131
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.