DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and CG34002

DIOPT Version :10

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster


Alignment Length:36 Identity:12/36 - (33%)
Similarity:18/36 - (50%) Gaps:4/36 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 GHFTQLIWKSSVEMGSGVA--RKADRT--WVVCNYN 153
            |||.::|...|..:|..:|  .|...|  |:.|.|:
  Fly   184 GHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 CAP_GAPR1-like 31..158 CDD:349401 12/36 (33%)
CG34002NP_001034029.2 CAP_euk 69..219 CDD:349399 11/34 (32%)

Return to query results.
Submit another query.