DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Glipr2

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_081726.1 Gene:Glipr2 / 384009 MGIID:1917770 Length:154 Species:Mus musculus


Alignment Length:150 Identity:55/150 - (36%)
Similarity:83/150 - (55%) Gaps:7/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KGNNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNP---KYGENI 86
            |..::.|..||....|:|||.||.|.:.:...||:.||:::..|.....:.|.|..   :.|||:
Mouse     3 KSASKQFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQCGENL 67

  Fly    87 FLSGGMDVTGDLPVEMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVARKAD-RTWVVC 150
            ..: ..|.||....:.||.||.||:|.:..|....||||.::||::.::|.|.|..:| .::||.
Mouse    68 AWA-SYDQTGKDVADRWYSEIKSYNFQQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVA 131

  Fly   151 NYNPPGNVV--GLFKDNVPP 168
            .|.|.||:|  |.|::||||
Mouse   132 RYFPAGNIVNQGFFEENVPP 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 46/130 (35%)
Glipr2NP_081726.1 CAP_GAPR1-like 8..139 CDD:349401 46/131 (35%)
Interaction with CAV1. /evidence=ECO:0000250 91..98 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.