DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and CG3640

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster


Alignment Length:227 Identity:46/227 - (20%)
Similarity:66/227 - (29%) Gaps:100/227 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FLKEVFNTTNKYRAM-------HGCPAVTINAALNK-------LAQE-----WANHLRDQNTMAH 76
            |:..|..|.|.:.|.       |.||..|.:.|.|.       ..:|     .:|.|  |..:.|
  Fly     8 FICLVIVTLNSFPAYSWDYCQEHWCPRSTDHVACNNNGTFGLDCGREARLIPLSNQL--QAFIVH 70

  Fly    77 RPNPKYGENIFLSGGMDVTG--------------------------------------------- 96
            :.|  :..|...|||:...|                                             
  Fly    71 QVN--FYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLT 133

  Fly    97 -----------DL-----PVEMWYREI--NSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVAR-K 142
                       ||     .:..|:.:.  .|.|...|........|.|||.:||..||.||.| :
  Fly   134 GHVIFSAGKHSDLELLRHKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVLRQR 198

  Fly   143 ADRTW----VVCNYNPPGNVVGLFKDNVPPKQ 170
            :...|    :|||:         .:.|:|.:|
  Fly   199 SHMLWHQQFIVCNF---------ARRNMPREQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 43/213 (20%)
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 29/158 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455139
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.