DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and CG9822

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster


Alignment Length:181 Identity:39/181 - (21%)
Similarity:61/181 - (33%) Gaps:47/181 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTHER-PPGPRGQDTKGNNELFLKEVFNTTNKYRAMHGCPA---------------VTINAALNK 59
            |.||. .|.....|.|...:|.:.| .|....|.|....|.               :...|.|| 
  Fly    46 KFHESCSPDATMVDLKPYRKLIVNE-HNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLN- 108

  Fly    60 LAQEWANHLRDQNTMAHRPNPKYGENIFLSGGMD--------VTG--DLPVEMWYRE----INSY 110
            |...:..|....|:...|   ..|:|:.   |:|        ||.  :..:.:|:.|    .:||
  Fly   109 LKTCYLEHDDCHNSYRFR---NLGQNLC---GVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSY 167

  Fly   111 --DFNKAQFVPTAGHFTQLIWKSSVEMGSGVARKADRTW-------VVCNY 152
              ||...:.:...|||.:.:...:..:|..:.|..:..:       ..|||
  Fly   168 ITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMRFTNPQYPFLYIYNTACNY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 32/160 (20%)
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 33/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455132
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.