DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and CG32679

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster


Alignment Length:113 Identity:34/113 - (30%)
Similarity:49/113 - (43%) Gaps:20/113 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 AALNKLAQEWANHLRDQNTMAHRPNPKY-GEN--IFLSGGMDVTGDL--PVEMWY---REINSYD 111
            ||.|.|....| |...:||..:|    | |:|  |..:..:||...|  .:..|:   |:..|.|
  Fly   102 AAYNALQCRMA-HDECRNTNTYR----YAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGD 161

  Fly   112 FNKAQF--VPTAGHFTQLIWKSSVEMGSGVARKAD-----RTWVVCNY 152
            ....|.  .|..||||.::.:.:..:|..:||..|     .|.:.|||
  Fly   162 MEDYQMRGGPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 34/113 (30%)
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 34/113 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455127
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
76.880

Return to query results.
Submit another query.