DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Crispld1

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:168 Identity:38/168 - (22%)
Similarity:65/168 - (38%) Gaps:38/168 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RGQDTKGNNELFLKEVFNTTNK-----YRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPN 79
            ||:....:|:  ::.:.:..||     |.|......:|.:..|.:.|:.||    :.....|.|.
  Rat    52 RGKRAITDND--MQSILDLHNKLRSQVYPAASNMEYMTWDVELERSAESWA----ETCLWEHGPT 110

  Fly    80 ---PKYGENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFV----------PTAGHFTQLIWKS 131
               |..|:|:....|........|:.||.|:..:.:......          |...|:||::|.:
  Rat   111 SLLPSIGQNLGAHWGRYRPPTFHVQAWYDEVRDFSYPYEHECDPYCPFRCSGPVCTHYTQVVWAT 175

  Fly   132 SVEMGSGVA------------RKADRTWVVCNYNPPGN 157
            |..:|..:.            .||  .::||||:|.||
  Rat   176 SSRIGCAINLCHNMNIWGQIWPKA--VYLVCNYSPKGN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 35/157 (22%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 31/149 (21%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.