DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Pi15

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001100387.1 Gene:Pi15 / 301489 RGDID:1309577 Length:258 Species:Rattus norvegicus


Alignment Length:140 Identity:40/140 - (28%)
Similarity:57/140 - (40%) Gaps:37/140 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LNKLAQEWANHLRDQNTMAHRPNPKY-----GENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQ 116
            |.|.|:.||      .|......|.|     |:|:.:..|...:....|:.||.|:..|.|...|
  Rat    97 LAKSAEAWA------ATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQ 155

  Fly   117 ----------FVPTAGHFTQLIWKSSVEMG------------SGVARKADRTWVVCNYNPPGNVV 159
                      |.|...|:||::|.:|..:|            ..|.|:|  .::||||.|.||.:
  Rat   156 DCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRA--VYLVCNYAPKGNWI 218

  Fly   160 G--LFKDNVP 167
            |  .:|..||
  Rat   219 GEAPYKVGVP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 35/127 (28%)
Pi15NP_001100387.1 SCP_euk 69..212 CDD:240180 32/122 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.