DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Glipr1

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:143 Identity:41/143 - (28%)
Similarity:66/143 - (46%) Gaps:10/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KGNNELFLKEVFNTTNKYRAMHGCPA-----VTINAALNKLAQEWANH-LRDQNTMAH-RPNPKY 82
            |..||.|::|.....|.:|:....||     ::.:..|.::|:.||.. :...|...| |.:|.:
  Rat    27 KITNEDFIEECVEVHNHFRSKAYPPAGNMLYMSWDPKLAQIAKAWAQSCVFQHNPQLHSRIHPNF 91

  Fly    83 ---GENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVARKAD 144
               ||||:|......:....:..|:.|...|||:..:.....||:||::|..|.::|..|.....
  Rat    92 TGLGENIWLGSLSLFSVRAAILAWFEESQYYDFSTGKCKKVCGHYTQIVWADSYKIGCAVQLCPR 156

  Fly   145 RTWVVCNYNPPGN 157
            ....:|||.|.||
  Rat   157 GANFICNYGPAGN 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 38/137 (28%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 36/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.