DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Pi16

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:153 Identity:45/153 - (29%)
Similarity:65/153 - (42%) Gaps:30/153 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NKYRAMHGCPAVTINAALNKLAQEWANHL-------RDQNTMAH-RPNPKYGENIF--LSGGMDV 94
            |.|||....|      |.:.|...|.:.|       ..:....| :...:.|||:|  ...||||
  Rat    47 NHYRAQVSPP------ASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGENLFAITDEGMDV 105

  Fly    95 TGDLPVEMWYREINSYDFNKAQFVP--TAGHFTQLIWKSSVEMGSGV--------ARKADRTWVV 149
              .|.|..|:.|...|:.:.|...|  ..||:||::|..:..:|.|.        ..:|:...:|
  Rat   106 --PLAVGNWHEEHEYYNLSTATCDPGQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLV 168

  Fly   150 CNYNPPGNVVGL--FKDNVPPKQ 170
            |||.|||||.|.  :::..|..|
  Rat   169 CNYEPPGNVKGRKPYQEGTPCSQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 40/137 (29%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.