DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and F09B9.5

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001024544.1 Gene:F09B9.5 / 259721 WormBaseID:WBGene00008604 Length:184 Species:Caenorhabditis elegans


Alignment Length:172 Identity:48/172 - (27%)
Similarity:73/172 - (42%) Gaps:38/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKYGENI-FLSGGMDV 94
            |:.::....|..|.||..|.:..:..|:::||:||:.|..|..::.......|||| |..  .|:
 Worm    10 FVDQMLLEHNTRRKMHSAPNLECSEELSEMAQQWADKLAKQAHISFSELSGIGENITFFP--PDI 72

  Fly    95 TGDLPVEMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVA--RKA-----DRT------ 146
            ..:..||.||:|...|::....:.....:|||:||:|:.|:|.|.|  ||:     |.|      
 Worm    73 DAESVVEHWYQEHEKYEYETPGWQTGTNYFTQVIWRSTKEIGVGCAYVRKSHENDEDNTSCSNGS 137

  Fly   147 --------------------WVVCNYNPPG--NVVGLFKDNV 166
                                .:|..|.|.|  |..|.|..||
 Worm   138 VCKSMTSLSSNGKLAAEGDKVIVAFYRPAGNNNRSGQFASNV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 43/162 (27%)
F09B9.5NP_001024544.1 CAP_GAPR1-like 9..168 CDD:349401 42/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I3781
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.