DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and CG30486

DIOPT Version :10

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster


Alignment Length:151 Identity:31/151 - (20%)
Similarity:57/151 - (37%) Gaps:33/151 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LKEVFNTTNKYRAMHGCPA---VTIN-----AALNKLAQEWANHLRD--QNT-----MAHRPNPK 81
            |.:..||..|.:..|..||   .|:.     |.|.|.|....:::.|  .||     :::    .
  Fly    68 LNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSY----I 128

  Fly    82 YGENIFLSGGMDVTG--DLPVEMWYREINSYDF------NKAQFVPTAGHFTQLIWKSSVEMGSG 138
            ||...:|....|...  |..::.|..::.....      ..|:.....|:||||:...:..:|..
  Fly   129 YGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCA 193

  Fly   139 VARKADRT------WVVCNYN 153
            :..:..:|      .|:|:::
  Fly   194 MMLRKGQTSGLYQYGVLCHFS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 CAP_GAPR1-like 31..158 CDD:349401 31/151 (21%)
CG30486NP_725234.2 CAP_euk 61..214 CDD:349399 31/149 (21%)

Return to query results.
Submit another query.