DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and D2062.1

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001293506.1 Gene:D2062.1 / 24104374 WormBaseID:WBGene00017055 Length:204 Species:Caenorhabditis elegans


Alignment Length:154 Identity:49/154 - (31%)
Similarity:78/154 - (50%) Gaps:16/154 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QDTKGNNELFLKE-VFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKYGEN 85
            ||..|.|...||| :....|.||:.||.|.:..:..::..|:.||:.:.....::|....|||||
 Worm    37 QDLAGYNIPKLKELIVAYHNLYRSKHGAPPLVADPVMDVAAKRWADEMAKSGWISHEKPRKYGEN 101

  Fly    86 I--FLSGGM----DVTGDLPVEMWYREINSYDFN--KAQFVPTAGHFTQLIWKSSVEMGSGVA-R 141
            :  |...|.    .......|.::|.|...||::  |.:.:...|||||::||||.::|.|:: .
 Worm   102 VAMFCQSGCWPLPQTLAQAMVHLFYIEGIGYDYSSFKPELLKENGHFTQIVWKSSRKIGVGISIG 166

  Fly   142 KADR-----TWVVC-NYNPPGNVV 159
            |:.:     |...| .::|||||:
 Worm   167 KSSQPPYIPTMFHCVKFDPPGNVL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 43/142 (30%)
D2062.1NP_001293506.1 CAP_GAPR1-like 46..189 CDD:349401 43/142 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161891
Domainoid 1 1.000 68 1.000 Domainoid score I6372
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4761
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.