DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and PI16

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001186088.1 Gene:PI16 / 221476 HGNCID:21245 Length:463 Species:Homo sapiens


Alignment Length:175 Identity:49/175 - (28%)
Similarity:70/175 - (40%) Gaps:34/175 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GPRGQDTKGNNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHL-------RDQNTMA 75
            ||.|..|.....|.::    ..|.|||.      ....|.:.|...|...|       ..|....
Human    23 GPVGALTDEEKRLMVE----LHNLYRAQ------VSPTASDMLHMRWDEELAAFAKAYARQCVWG 77

  Fly    76 H-RPNPKYGENIF--LSGGMDVTGDLPVEMWYREINSYDFNKAQFVP--TAGHFTQLIWKSSVEM 135
            | :...:.|||:|  ...||||  .|.:|.|:.|...|:.:.|...|  ..||:||::|..:..:
Human    78 HNKERGRRGENLFAITDEGMDV--PLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERI 140

  Fly   136 GSGV--------ARKADRTWVVCNYNPPGNVVGL--FKDNVPPKQ 170
            |.|.        ..:.:...:||||.|||||.|.  :::..|..|
Human   141 GCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQ 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 39/146 (27%)
PI16NP_001186088.1 SCP_HrTT-1 33..166 CDD:240186 36/144 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..281
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..408
O-glycosylated at one site 386..395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.