DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Ralgds

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_006497859.1 Gene:Ralgds / 19730 MGIID:107485 Length:908 Species:Mus musculus


Alignment Length:154 Identity:31/154 - (20%)
Similarity:56/154 - (36%) Gaps:32/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QDTKGNNELFLKEVFNTTNKYRAMH---GCPAVTINAALNKLAQEWANHLRDQNTMA--HRPNPK 81
            |....|..:..:|.|.|.  :|||.   ...:.|::..|...::..:|.||.:.:.|  .|.:.:
Mouse   603 QSACNNYSIAPEEHFGTW--FRAMERLSEAESYTLSCELEPPSESASNTLRSKKSTAIVKRWSDR 665

  Fly    82 YGENIFLS-------------------GGMDVTGDLPVEMWYREINSYDFNKAQFVPTA--GHFT 125
            ...:..||                   |..|:|..|.|.......:..:.....|||.:  |. .
Mouse   666 QAPSTELSTSSSAHSKSCDQLRCSPYLGSGDITDALSVHSAGSSSSDVEEINMSFVPESPDGQ-E 729

  Fly   126 QLIWKSSVEMG---SGVARKADRT 146
            :..|:|:.:..   ||::..:..|
Mouse   730 KKFWESASQSSPETSGISSASSST 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 29/145 (20%)
RalgdsXP_006497859.1 RasGEFN 112..249 CDD:214571
RasGEF 376..643 CDD:214539 10/41 (24%)
RA_RalGDS 792..877 CDD:340729
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2621
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.