DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and scl-19

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_507654.2 Gene:scl-19 / 191308 WormBaseID:WBGene00013971 Length:207 Species:Caenorhabditis elegans


Alignment Length:174 Identity:39/174 - (22%)
Similarity:60/174 - (34%) Gaps:65/174 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKRNVAPIPKTHERPPGPRGQDTKGNNELFLK--EVFNTTNKYRAMHGCPAVTINAALNKLAQE 63
            :|:..||..|...|.|.|    ...|.|....|  |.:|:.::|          :..|||    :
 Worm    67 LAQDYVADCPDGLEIPIG----RNIGMNYYTTKVDETYNSMDEY----------VIDALN----D 113

  Fly    64 WANHLRDQNTMAHRPNPKYGENIFLSGGMDVTGDLPVEMWYREI-NSYDFNKAQFVPTAGHFTQL 127
            ||.                              :..|..|...| |....:.|         :|:
 Worm   114 WAE------------------------------EFQVNGWLSTIYNDTSISAA---------SQM 139

  Fly   128 IWKSSVEMGSGVARKAD--RTWVVCNYNPPGNVVG--LFKDNVP 167
            :|..:..:|.|| ::.|  ...|||.|...||:||  ::|:..|
 Worm   140 VWAGTKYVGCGV-KRCDPINVVVVCMYYQQGNLVGRPIYKEGPP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 25/131 (19%)
scl-19NP_507654.2 SCP 21..167 CDD:214553 33/157 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.