DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and scl-25

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_507364.1 Gene:scl-25 / 188600 WormBaseID:WBGene00011841 Length:212 Species:Caenorhabditis elegans


Alignment Length:154 Identity:29/154 - (18%)
Similarity:56/154 - (36%) Gaps:54/154 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NKYR--AMHGC-PAVTINAALNKLAQEWANHLRDQNTMAHRPNPKY----GENIFLSGGMDVTGD 97
            ||.|  |.||. ...:|:.:.|.....|     :::.:|...|.||    .:|          .:
 Worm    39 NKLRNAASHGLWERHSISKSSNMQLLSW-----NESLVAEAENEKYYCEPADN----------KN 88

  Fly    98 LPVEM----WYREINSYD----------FN-------KAQFVPTAGHFTQLIWKSSVEMGSGVAR 141
            ||:::    :..::|:||          .|       |::.........|:::..|..:|. :..
 Worm    89 LPIKLGDNIYQYDVNTYDDIDGVGAMGSINKDTHDALKSEAKAAKNRLRQMLYSKSKSIGC-IYE 152

  Fly   142 KADR----------TWVVCNYNPP 155
            ..|:          ..::|.|:||
 Worm   153 SCDKIDSKGINYNTRLLICKYSPP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 29/154 (19%)
scl-25NP_507364.1 CAP_euk 31..174 CDD:349399 26/150 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.