DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and F58E2.5

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_500349.1 Gene:F58E2.5 / 186521 WormBaseID:WBGene00019049 Length:232 Species:Caenorhabditis elegans


Alignment Length:186 Identity:43/186 - (23%)
Similarity:61/186 - (32%) Gaps:56/186 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFL--------KEVFNTTNKYRA--MHGC-------PAVTI-------------NAALNKLAQEW 64
            |||        |::.|..|..|:  .:|.       |.:||             |..|..|||.:
 Worm    30 LFLNLASAIAHKDILNAYNNLRSEIANGTFTMKLQFPDITIPLAPAAGMLKLKWNCRLAALAQAY 94

  Fly    65 ANHLRD-QNTMAHRPNPKYGENI-FLSGGMDVTGDLPVEMWYR-EINSYDFNKAQFVPTAGHFTQ 126
            .:.... |:...|:  ||:.... ||...:......||  .|| :|...||.:...  ....|.:
 Worm    95 VDSCPSYQDLRVHK--PKFPVTYSFLDANLQEHIKDPV--LYRFKILEMDFRRGYI--NDDWFKK 153

  Fly   127 LIWKSSVEMGSGVARKADRTWVVCNYN---------------PPGNVVGLFKDNVP 167
            ||  ||..:|......::....||.|.               .||..:....|.||
 Worm   154 LI--SSKSIGCAFNNCSENVLFVCYYKEQIYEDFKFPVNGGAEPGRFIKELDDYVP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 39/174 (22%)
F58E2.5NP_500349.1 CAP_euk 40..177 CDD:349399 34/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.