DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and F57B7.2

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001367203.1 Gene:F57B7.2 / 186438 WormBaseID:WBGene00010192 Length:330 Species:Caenorhabditis elegans


Alignment Length:153 Identity:44/153 - (28%)
Similarity:70/153 - (45%) Gaps:20/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKYGENIFLSGGMD-- 93
            |.:...:..|:.|..:|...:..:..|.::|..||..|.|:..:.:...|..|||:.|....:  
 Worm   154 FQRSCLDAHNECRQRYGNENLCWSTELAEMAHAWAVKLADRGRVLYPELPGIGENLILKEANEQS 218

  Fly    94 --VTGDLPVEMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVARKADRTW--------V 148
              .||...::.|.:|...:||:|.::.|....|:|::||.:.|:|      |.|.|        |
 Worm   219 HLPTGQEVIQEWEKEAQFFDFDKPRWNPKCQRFSQVVWKDTTELG------AARYWNTANNCVAV 277

  Fly   149 VCNYNPPG--NVVGLFKDNVPPK 169
            ||.|.|.|  |..|.|..|||.:
 Worm   278 VCFYRPAGNSNAPGEFASNVPSR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 38/140 (27%)
F57B7.2NP_001367203.1 CAP_GAPR1-like 153..286 CDD:349401 37/137 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.