DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and scl-11

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_502499.1 Gene:scl-11 / 186050 WormBaseID:WBGene00009892 Length:207 Species:Caenorhabditis elegans


Alignment Length:124 Identity:34/124 - (27%)
Similarity:47/124 - (37%) Gaps:26/124 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NAALNKLAQEWANHLRDQNTMAHRPNPKYGENIF------LSGGMDVTGDLPVEMWYREINSY-- 110
            :|.:...||.:||..    ...|.....||||::      ..|.:|..|......|..|...|  
 Worm    61 DATVATSAQNYANTC----PTGHSQGSGYGENLYWYWTSGTIGNLDTFGPAASSSWESEFQQYGW 121

  Fly   111 -----DFNKAQFVPTAGHFTQLIWKSSVEMGSGV-------ARKADRTWVVCNYNPPGN 157
                 |.|  .|....||.||:.|.::..:|.||       :...::..|||.|..|||
 Worm   122 TSNTLDMN--TFNTGIGHATQMAWANTFAIGCGVKNCGKDPSNGYNKVAVVCQYKTPGN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 34/124 (27%)
scl-11NP_502499.1 SCP 21..173 CDD:214553 30/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.