DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and scl-15

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_494496.1 Gene:scl-15 / 184099 WormBaseID:WBGene00017183 Length:207 Species:Caenorhabditis elegans


Alignment Length:169 Identity:46/169 - (27%)
Similarity:66/169 - (39%) Gaps:36/169 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQDTKGNNELFLKEVFNT-----------TNKYRAMHGCPAVTI--NAALNKLAQEWANHLRDQN 72
            ||.:|...:..: :..||           .||.|...|...:.:  :..:.|.||.:||     .
 Worm    17 GQFSKAGQKAIV-DAHNTLRSSIAKGTYVANKTRKEPGSNILKMKWDPTIAKSAQAYAN-----T 75

  Fly    73 TMAHRPNPKYGENIF--LSG----GMDVTGDLPVEMWYREINSYDF--NK---AQFVPTAGHFTQ 126
            ........|||||::  .||    .:|..|......|..|...|.:  ||   |.|....||.||
 Worm    76 CPTGHGKSKYGENLYWRWSGAVIKSIDDYGVRASGAWASEFQKYGWKTNKLDSALFKTGIGHATQ 140

  Fly   127 LIWKSSVEMGSGV------ARKADRTWVVCNYNPPGNVV 159
            :.|.|:..:|.||      ..|..:..|||.|:..||::
 Worm   141 MAWASTGSIGCGVKNCGMDKNKMYKVAVVCQYSARGNMI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 42/156 (27%)
scl-15NP_494496.1 SCP 22..173 CDD:214553 40/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161873
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.