DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and C07A4.3

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_509707.2 Gene:C07A4.3 / 182352 WormBaseID:WBGene00007398 Length:207 Species:Caenorhabditis elegans


Alignment Length:160 Identity:56/160 - (35%)
Similarity:81/160 - (50%) Gaps:31/160 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLR-DQNTMAHRPNPKYGENI--FLSGGMDV 94
            |.:.:..|||||.|..||||:::.|..|||:|::.:. .:..:.|....|||||:  |.|     
 Worm    46 KWIVHFHNKYRAHHSSPAVTVDSNLTNLAQKWSDEMAFHKKCLVHEQPSKYGENLTSFAS----- 105

  Fly    95 TGDLP---------VEMWYREINSYDFNKAQFVP----TAGHFTQLIWKSSVEMGSG--VARKAD 144
             ...|         :..:|.|  .|.||..:|.|    ..||||||:||:|.::|.|  ||::..
 Worm   106 -SKFPSPKTCAAALIHGFYTE--GYGFNYTRFNPGSWSKVGHFTQLLWKNSRKIGVGVSVAKRGT 167

  Fly   145 --RTWVVCNYNPPGNV--VGLFKDNV-PPK 169
              ..:|...|:||||:  ...:.||| .||
 Worm   168 MYHVYVCIKYDPPGNMQTSEAYMDNVRAPK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 50/144 (35%)
C07A4.3NP_509707.2 CAP_GAPR1-like 43..183 CDD:349401 50/144 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I6372
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4761
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.