DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and C07A4.2

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_509706.2 Gene:C07A4.2 / 182351 WormBaseID:WBGene00007397 Length:417 Species:Caenorhabditis elegans


Alignment Length:155 Identity:47/155 - (30%)
Similarity:72/155 - (46%) Gaps:34/155 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LKE-VFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLR-DQNTMAHRPNPKYGENIFLSGGMDV 94
            ||| :.:..|.||:.||.||:..::.|:...:.||:.|. .:..:.|.....||||:|..|..  
 Worm   252 LKEWLVSYHNVYRSKHGAPALISDSVLDSRGKRWADELAYHKGCLVHEQPRTYGENLFFFGAR-- 314

  Fly    95 TGDLP---------VEMWYREINSYDFNK---AQFVPTAGHFTQLIWKSSVEMGSGVARKADRT- 146
              .||         ::.:|.|...|:::.   ..|..| |||||||||:|.::|.||:.....: 
 Worm   315 --HLPSPQTLAAAVIQSFYLEGIGYNYSSWRPMSFFKT-GHFTQLIWKNSRKIGVGVSIVKSSSI 376

  Fly   147 --------------WVVCNYNPPGN 157
                          :||..|:|.||
 Worm   377 RSPCVSSSPNMYFIYVVVKYDPAGN 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 47/155 (30%)
C07A4.2NP_509706.2 CAP_GAPR1-like 251..402 CDD:349401 47/155 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161890
Domainoid 1 1.000 68 1.000 Domainoid score I6372
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4761
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.750

Return to query results.
Submit another query.