DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and lon-1

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_498166.1 Gene:lon-1 / 175753 WormBaseID:WBGene00003055 Length:312 Species:Caenorhabditis elegans


Alignment Length:178 Identity:46/178 - (25%)
Similarity:72/178 - (40%) Gaps:32/178 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IPKTHERPPGPRG-------QDTKG-------NNELFLKEVFNTTNKYRAMHGCPAVTINAAL-- 57
            :|.|.|.....||       |...|       .||...|.:.:..|:||.|  .||..:|...  
 Worm    44 LPATDEVKREKRGYFFPSHFQSDSGLLSRSEHPNEYLKKWITHEHNRYRRM--VPASDMNMLYWS 106

  Fly    58 NKLAQEWANHLRDQNTMAHRPNPKYGENIFLSGGMDVTGDLPVEMWYREINS--YDFNKAQFVPT 120
            ::||.....|....:....|.....||||:.:...:.:.  .:.:|:.|:::  ...|.| :...
 Worm   107 DELAASAQRHADTCDFRHSRGRINVGENIWAAPYSNYSD--AISIWFNEVHNPRCGCNHA-YKHC 168

  Fly   121 AGHFTQLIWKSSVEMGSGVARKAD---------RTWVVCNYNPPGNVV 159
            .||:.|::|..:..:|.|.:|..|         |...||:|||.||.|
 Worm   169 CGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGNTV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 35/139 (25%)
lon-1NP_498166.1 SCP 81..211 CDD:214553 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.